PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G224800.1.p
Common NameSb07g028990, SORBIDRAFT_07g028990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 325aa    MW: 35145.4 Da    PI: 6.2755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G224800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEde+l++++++ G g+W+t +r  g++R++k+c++rw +yl
  Sobic.007G224800.1.p 14 KGPWTQEEDEKLLHYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding54.33.2e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  Sobic.007G224800.1.p  67 RGKFSQEEEQTILHLHSVLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.38961IPR017930Myb domain
SuperFamilySSF466892.54E-3111108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
CDDcd001671.61E-111661No hitNo description
PROSITE profilePS5129426.67862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2765117IPR009057Homeodomain-like
SMARTSM007172.5E-1666114IPR001005SANT/Myb domain
PfamPF002494.0E-1667112IPR001005SANT/Myb domain
CDDcd001672.61E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTQE EDEKLLHYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSVLGNKWS AIATHLPGRT DNEIKNFWNT HLKKRLIQMG  120
FDPMTHRPRT DFFAALPQLI ALAALRQHLQ LGDQQQAAKL QYLQSLLQSA ATTISSSDTE  180
APALGLGAIC CSPPQLTTTP LDSCTAPVSS SLLPCTFPEA APPVSSEEDE ANNHQQQQTA  240
GLSSSYGGLG SADDVFACHG GSSSSSLPPL TDLSDAHAGS LLQVDGSMRS ATASSSFGGG  300
SSCSPLPWPE LFFPDDDPFI TDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-30121162105C-Myb DNA-Binding Domain
1msf_C3e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283090.0KJ728309.1 Zea mays clone pUT6589 MYB transcription factor (MYB63) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444838.10.0hypothetical protein SORBIDRAFT_07g028990
SwissprotQ8GWP02e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLC5YJP70.0C5YJP7_SORBI; Putative uncharacterized protein Sb07g028990
STRINGSb07g028990.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.16e-86myb domain protein 93